PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00230.1.g00260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 429aa    MW: 47360.6 Da    PI: 8.8883
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00230.1.g00260.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.96.8e-561112361128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv++yL++kv++  +++ ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sg
  Zmw_sc00230.1.g00260.1.am.mk 111 LPPGFRFHPTDEELVTYYLTRKVSDFAFTT-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSG 190
                                   79*************************999.89***************999999*************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWk+tgkdke+++  g lvg+kktLvfy+grapkgekt+Wvmheyrl
  Zmw_sc00230.1.g00260.1.am.mk 191 YWKTTGKDKEIFH-CGMLVGMKKTLVFYRGRAPKGEKTSWVMHEYRL 236
                                   *************.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-64108257IPR003441NAC domain
PROSITE profilePS5100560.287111257IPR003441NAC domain
PfamPF023655.1E-29112236IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MACKLPRAWC RPGLRYPPCR WVRGGWSWLE TPPARTGVSL RSMLLSTAAL FLPRPVAVAV  60
ADNPCRRFLG PRLILCLCAC AFLALPVYIY APLPEARAAA IAASCRLCEG LPPGFRFHPT  120
DEELVTYYLT RKVSDFAFTT RAIADVDLNK CEPWDLPSKA SMGEKEWYFF SMRDRKYPTG  180
IRTNRATDSG YWKTTGKDKE IFHCGMLVGM KKTLVFYRGR APKGEKTSWV MHEYRLQNKF  240
PYKPNKEEWV VCRVFKKCQI IKMRPPTDSP TMGSPCHDGN QSLGELGELD VSSILGSLTP  300
ASMHTSSSSP GEGFGHRMDM NAYLSWMAAA NQGAVAAATA AMLPWATAPG LFSNVFAAPS  360
PLGQKSLPYA GCSSSQPRDI SAVVANIGGD HAMFGSSVAK VDMECDRQQQ APTPPEQQPG  420
MDESTWRAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-5511125720168NAC domain-containing protein 19
3swp_C3e-5511125720168NAC domain-containing protein 19
3swp_B3e-5511125720168NAC domain-containing protein 19
3swp_A3e-5511125720168NAC domain-containing protein 19
3swm_D3e-5511125720168NAC domain-containing protein 19
3swm_C3e-5511125720168NAC domain-containing protein 19
3swm_B3e-5511125720168NAC domain-containing protein 19
3swm_A3e-5511125720168NAC domain-containing protein 19
4dul_B3e-5511125717165NAC domain-containing protein 19
4dul_A3e-5511125717165NAC domain-containing protein 19
1ut7_B3e-5511125717165NO APICAL MERISTEM PROTEIN
1ut7_A3e-5511125717165NO APICAL MERISTEM PROTEIN
1ut4_B3e-5511125717165NO APICAL MERISTEM PROTEIN
1ut4_A3e-5511125717165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982400.11e-166PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK4ACC81e-166K4ACC8_SETIT; Uncharacterized protein
STRINGSi036535m1e-166(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450